PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do026281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 275aa    MW: 29880.6 Da    PI: 5.5319
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do026281.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.73.3e-10126168850
                 HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                 r+   NReA r++R++Kka  + Lee+vk+L a N++L  +l+
  Do026281.1 126 RKPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQ 168
                 66677*********************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-8114186IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-14117187No hitNo description
PROSITE profilePS502178.6121168IPR004827Basic-leucine zipper domain
PfamPF077164.7E-13121176IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.63E-7125169No hitNo description
CDDcd146862.43E-12126177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MLPRSTTEFS GEVCCPATCK FVSSAIHLFC LLISDQRRKI VPDTFSVTMD DGADLPYQLL  60
FSHPEMPDSF DEFLNSATTT CTHTHSCNPP GPSAPMHTHT CLHTHTQVFA GGAEDDDARE  120
DPAKPRKPLG NREAVRKYRE KKKAHAAFLE EEVKKLRAAN QQLLRRLQGH AALEAEVVRL  180
RSLLLDVRCK IDADVGAFPF QKPCSVGSVG CADPALCCNG NSEVAGAWEE SSVPSAADCR  240
IDEGGGLSRE IDVTEGLHHS MDVVASFVSS DSLAE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008647614.11e-127PREDICTED: putative bZIP transcription factor superfamily protein isoform 1 isoform X1
SwissprotQ8GTS22e-53BZP23_ARATH; Basic leucine zipper 23
TrEMBLB4G1L81e-126B4G1L8_MAIZE; Uncharacterized protein
STRINGGRMZM2G175870_P011e-125(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-23bZIP family protein